PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0487s0230.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 345aa    MW: 39545 Da    PI: 4.7308
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0487s0230.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-54101391129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL +     ++e++ewyfFs++dkky+tg+r+nrat +g+Wk
  SapurV1A.0487s0230.2.p  10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLLErcwIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWK 95 
                             69****************************.9***************743543344678**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             atg+dk+v++ k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  SapurV1A.0487s0230.2.p  96 ATGRDKAVYD-KIKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139
                             **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-613159IPR003441NAC domain
PROSITE profilePS5100558.8110159IPR003441NAC domain
PfamPF023657.1E-2911138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MKESMDQSGV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLLERCW  60
IGYEEQNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAVYDKIKLI GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLES DENGPPQEEG WVVCRAFKKR TTGQTKSIEG WESSYFYEES  180
SGVSSVVDPI DYMARQPDHS FLAHNFLCKQ EIEGDNLSFM HSEDFVQLPQ LESPSEPLIK  240
RPTSSMFLIP ENNNSTNEEG EQNRLSNNNT QKVTDWRALD KFVASQLSQE ERYDGDGASS  300
LVGAENNSDF PLLLVQSGRD DGSTFNGFLS SSSDCDIGIC IFEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-51316410170NAC domain-containing protein 19
4dul_A7e-51316410170NAC domain-containing protein 19
1ut7_B7e-51316410170NO APICAL MERISTEM PROTEIN
1ut7_A7e-51316410170NO APICAL MERISTEM PROTEIN
1ut4_B7e-51316410170NO APICAL MERISTEM PROTEIN
1ut4_A7e-51316410170NO APICAL MERISTEM PROTEIN
3swp_D9e-51316413173NAC domain-containing protein 19
3swp_C9e-51316413173NAC domain-containing protein 19
3swp_B9e-51316413173NAC domain-containing protein 19
3swp_A9e-51316413173NAC domain-containing protein 19
3swm_D9e-51316413173NAC domain-containing protein 19
3swm_C9e-51316413173NAC domain-containing protein 19
3swm_B9e-51316413173NAC domain-containing protein 19
3swm_A9e-51316413173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999330.0AB599933.1 Populus trichocarpa PtVNS02 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307355.20.0hypothetical protein POPTR_0005s11870g
SwissprotQ9SL411e-162NAC37_ARATH; NAC domain-containing protein 37
TrEMBLB9H6Z10.0B9H6Z1_POPTR; Transcription factor
STRINGPOPTR_0005s11870.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-161vascular related NAC-domain protein 1